DPCfam | MC289246
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 281 |
|---|---|
| Mean domain length (aa) | 1639 ± 257 aa |
| Residues in low-complexity regions (%) | 3.17 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.34 |
| Average transmembrane regions | 0.57 |
| Dominant Pfam architecture(s) | PF16507- PF11919 |
| Sequences matching dominant architecture (%) | 53.31 |
| Average overlap percent | 87.87 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| L8H588 | 416-1755 | 1340 | LFFQQLSPQIYTTLSKKLLHFVTYNVVPNATKEFGFLVASASLANPEAALKTYLPLCYKKIIKLSKETGAATLKDRSDDEMKWYL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175WCS9-F1 | 121-1950 | 100.00 | 89.08 | View in AlphaFoldDB ↗ |