DPCfam | MC289132
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 213 ± 42 aa |
| Residues in low-complexity regions (%) | 3.05 |
| Residues in coiled-coil regions (%) | 22.45 |
| Predicted disordered residues (%) | 47.02 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF17942 |
| Sequences matching dominant architecture (%) | 92.86 |
| Average overlap percent | 14.39 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A103XWK2 | 481-659 | 179 | VVGVLEANFIEPTHDKQDFEKTSLFQKLVQRLKEMTWEYWDCHCGLIGYQFQKKGRPPSAAPGYPNFIHHHGTEPPALSRKSAPV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7V837-F1 | 446-745 | 99.16 | 54.20 | View in AlphaFoldDB ↗ |