DPCfam | MC288978
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 172 ± 19 aa |
| Residues in low-complexity regions (%) | 16.68 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.22 |
| Average transmembrane regions | 1.58 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000411AE2E | 30-174 | 145 | NFRGLGETADQAVRIDGSAQVHAEAGDTLLYYFPGDEADSRCEVEGPDPQSLRTHLSSSFTFEGTQYRSQGGFHAGASGTYTVTC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F8J2-F1 | 23-196 | 97.13 | 87.24 | View in AlphaFoldDB ↗ |