DPCfam | MC288751
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 72 ± 5 aa |
| Residues in low-complexity regions (%) | 14.5 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.76 |
| Average transmembrane regions | 1.33 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0008F88BA3 | 1-62 | 62 | MKIIAITMLIMVGVSTLTISLDILLGIGVSTSIFNAIRPFRVMDAAETFIILLFTLLFFVEN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O31479-F1 | 1-72 | 98.65 | 85.51 | View in AlphaFoldDB ↗ |