DPCfam | MC28875
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 301 |
|---|---|
| Mean domain length (aa) | 218 ± 36 aa |
| Residues in low-complexity regions (%) | 11.24 |
| Residues in coiled-coil regions (%) | 0.94 |
| Predicted disordered residues (%) | 11.95 |
| Average transmembrane regions | 3.78 |
| Dominant Pfam architecture(s) | PF04144 |
| Sequences matching dominant architecture (%) | 91.79 |
| Average overlap percent | 71.73 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A096P9J3 | 123-348 | 226 | AAQQRDLERREAEVVRRERDLEVRERNVRGSGAGGQTYNWPFKCWAIAYHNIAAEIPQEHKRCVQMCYLVYCIFVLALLCNFIVV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7ZV08-F1 | 74-296 | 99.09 | 88.82 | View in AlphaFoldDB ↗ |