DPCfam | MC288554
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 104 ± 10 aa |
| Residues in low-complexity regions (%) | 2.38 |
| Residues in coiled-coil regions (%) | 0.19 |
| Predicted disordered residues (%) | 13.29 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09786 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 31.39 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A7RW31 | 2-96 | 95 | IWNKLGITRADLDHWTENCRKWLCQTILVRLVEQIDSVNDVLCRIGCQELQIGTISLSSLRQVAVTKADQVPQLRAIIPYLEAST... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3Q0KSR0-F1 | 212-313 | 100.00 | 89.00 | View in AlphaFoldDB ↗ |