DPCfam | MC288030
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 321 |
|---|---|
| Mean domain length (aa) | 101 ± 11 aa |
| Residues in low-complexity regions (%) | 3.55 |
| Residues in coiled-coil regions (%) | 1.13 |
| Predicted disordered residues (%) | 17.48 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF01399 |
| Sequences matching dominant architecture (%) | 49.84 |
| Average overlap percent | 57.4 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R4UKU7 | 1-89 | 89 | MAKYYTRITLKRMAELLDLPVEETEDFLSNLVVNKTVLAKTDRPAGVVSFTQSKDPNDVLNDWSNHLSTLMQLVNKTTHLINKEE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-G4LX66-F1 | 340-441 | 99.02 | 89.06 | View in AlphaFoldDB ↗ |