DPCfam | MC287803
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 911 |
|---|---|
| Mean domain length (aa) | 375 ± 45 aa |
| Residues in low-complexity regions (%) | 2.87 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.23 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF01232- PF08125 |
| Sequences matching dominant architecture (%) | 87.6 |
| Average overlap percent | 94.96 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J0EDL0 | 25-438 | 414 | RIVHLGCGAFHRAHQALYTHHVLEKTDSDWGYCEVNLISKHDAALIENLKQQSMLYTVAEKGETHTELKIIGSMKEALHPLIDGI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I1D6-F1 | 28-429 | 99.73 | 97.09 | View in AlphaFoldDB ↗ |