DPCfam | MC287683
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 158 ± 19 aa |
| Residues in low-complexity regions (%) | 0.54 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 5.97 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03635 |
| Sequences matching dominant architecture (%) | 7.41 |
| Average overlap percent | 20.35 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D2M6J0 | 222-361 | 140 | PEVAKETCKNWFYKVGSIRELLPRLAIELAILKSYSFIVPNPEYGKILIRLLNSAWGIGDPVVAIYLRCYLCRVAMELVPEEKEL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A4VCH4-F1 | 267-418 | 100.00 | 93.50 | View in AlphaFoldDB ↗ |