DPCfam | MC28768
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 102 ± 6 aa |
| Residues in low-complexity regions (%) | 2.45 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.93 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14656 |
| Sequences matching dominant architecture (%) | 94.59 |
| Average overlap percent | 23.33 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q8BMG7 | 1263-1364 | 102 | EEAIFQVQDKEVLASQLLVLTGQRLAHALFHTQTKEGMELLARLPPTLCTWLKAMNPQDLQNTGVPIAATAKLVHKVMELLPEKH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7DYN0-F1 | 1238-1341 | 98.08 | 84.12 | View in AlphaFoldDB ↗ |