DPCfam | MC287634
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 541 |
|---|---|
| Mean domain length (aa) | 508 ± 75 aa |
| Residues in low-complexity regions (%) | 2.13 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.76 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF05170 |
| Sequences matching dominant architecture (%) | 1.31 |
| Average overlap percent | 23.46 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R9GMT1 | 48-623 | 576 | IVLEGLYVQDRDKDTLLYTPKFSVDLNLLSLKNKTIDINTIQLDSGSFFLKRYPNKTTNLQFILDYFNSGKPKQKTTGKPYTITL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1QQL4-F1 | 1100-1389 | 63.04 | 28.59 | View in AlphaFoldDB ↗ |