DPCfam | MC287216
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Residues in low-complexity regions (%) | 1.88 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 34.42 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06565 |
| Sequences matching dominant architecture (%) | 91.43 |
| Average overlap percent | 5.47 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G4V5T5 | 1-80 | 80 | MALPFLPGYNFNKNIGKDKFHKSHYLTLKGNEAYMHGDDKPGIGGEKLPGQRINAPTSVYPSGIGSQLPAWLAFDKQALS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5JST6-F1 | 3-78 | 100.00 | 73.61 | View in AlphaFoldDB ↗ |