DPCfam | MC287111
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 182 ± 21 aa |
| Residues in low-complexity regions (%) | 2.55 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.92 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13021 |
| Sequences matching dominant architecture (%) | 86.67 |
| Average overlap percent | 18.68 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F0F400 | 9-205 | 197 | HIFSGLAFARPLFYNYPHGLRFELAEGGSDIERFLLAVSKATAVCRDLFAGEQSLVVCLRTHTDGNGFARRELLRGLQAAGIRIP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P94483-F1 | 18-211 | 94.27 | 92.63 | View in AlphaFoldDB ↗ |