DPCfam | MC286559
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 180 ± 16 aa |
| Residues in low-complexity regions (%) | 19.23 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.26 |
| Average transmembrane regions | 2.57 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C7Q125 | 36-219 | 184 | YKMGHNRHYENYLTSNVRDALKALPRLIGMCVRLSLRADRRSTYLLIGAQLALGASTAFGLLATNGVLRALLAEGPSPQRVKAAA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EW03-F1 | 13-196 | 98.39 | 85.56 | View in AlphaFoldDB ↗ |