DPCfam | MC286126
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 381 |
|---|---|
| Mean domain length (aa) | 157 ± 21 aa |
| Residues in low-complexity regions (%) | 2.11 |
| Residues in coiled-coil regions (%) | 0.04 |
| Predicted disordered residues (%) | 26.99 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF02806 |
| Sequences matching dominant architecture (%) | 45.05 |
| Average overlap percent | 42.03 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C1BN34 | 296-422 | 127 | GGDNSVITHKNPHIYKMASAFLLAHSYGQKRVMSSYYFNDSDQGPPLDSRPKDCNAWVCEHRWPEIRNMVRFANIVGDSEVLHYQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q23835-F1 | 319-477 | 99.38 | 97.82 | View in AlphaFoldDB ↗ |