DPCfam | MC286040
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 415 ± 41 aa |
| Residues in low-complexity regions (%) | 3.48 |
| Residues in coiled-coil regions (%) | 2.78 |
| Predicted disordered residues (%) | 14.42 |
| Average transmembrane regions | 0.2 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W4X1X7 | 184-634 | 451 | PFTESQLTSLYMNIELESVDQFVCDFIEAELKGTLKKHRLYELLDNYLLIRNKITGNTLEFEQLRKEYKESLDSLWSIETAMISG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HCE0-F1 | 255-661 | 99.76 | 79.24 | View in AlphaFoldDB ↗ |