DPCfam | MC285962
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 497 ± 75 aa |
| Residues in low-complexity regions (%) | 4.13 |
| Residues in coiled-coil regions (%) | 0.03 |
| Predicted disordered residues (%) | 28.52 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF09818 |
| Sequences matching dominant architecture (%) | 92.68 |
| Average overlap percent | 81.44 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0N0I618 | 9-356 | 348 | GKSGLVLIDAPGQKVLERTAVQVTDETITVCLSVGLPAHGRRILAKEAEAIFFEQIPSVIERAVCGLRDEDIRPAVELADQQHAI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q57ZF2-F1 | 62-574 | 93.86 | 95.45 | View in AlphaFoldDB ↗ |