DPCfam | MC28570
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 175 ± 22 aa |
| Residues in low-complexity regions (%) | 8.58 |
| Residues in coiled-coil regions (%) | 0.36 |
| Predicted disordered residues (%) | 26.41 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A117RMI5 | 331-521 | 191 | VYLLGHEELQAQAEDMLSAAELSRYRQKLYAWADEWAARGWPDGTPHYLLRGYFRMLWADGDLDRMLRCALDEARHDRMLLLTGG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0P0VRC2-F1 | 338-416 | 43.17 | 89.16 | View in AlphaFoldDB ↗ |