DPCfam | MC28561
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 519 ± 63 aa |
| Residues in low-complexity regions (%) | 3.06 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.63 |
| Average transmembrane regions | 0.73 |
| Dominant Pfam architecture(s) | PF14237 |
| Sequences matching dominant architecture (%) | 45.19 |
| Average overlap percent | 9.64 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H2Z525 | 299-878 | 580 | LFHSFTIDHAKPNLIWNHKTREELKTALENEMRAFHIDQELGRTTEIAWNHNEFEVTIKLFFHISIFVQYECLADEIKIGDYFLR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D4AFX7-F1 | 772-1313 | 99.45 | 81.45 | View in AlphaFoldDB ↗ |