DPCfam | MC285450
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 791 |
|---|---|
| Mean domain length (aa) | 85 ± 12 aa |
| Residues in low-complexity regions (%) | 0.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.63 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00675- PF05193 |
| Sequences matching dominant architecture (%) | 58.46 |
| Average overlap percent | 26.86 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0L8HQL6 | 226-308 | 83 | HPIGNFIEGNLTSLRTDPNKSNINVYSRLKEFHKKMYSAHFMTLAVQSKETLDVLDEWVREIFSNVPNNNEAKPTFSHEPCPF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2GTM6-F1 | 185-271 | 97.75 | 95.57 | View in AlphaFoldDB ↗ |