DPCfam | MC285435
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 361 ± 38 aa |
| Residues in low-complexity regions (%) | 1.53 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.09 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C4JSR9 | 956-1281 | 326 | QVRSAFKACSLVYIRSQNLWCKPSSCLWTVAPRVGNQFGIASDYGELEELFVSRLLVQAPTIATYIEQLKTVSTGGSPNRQDIQS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VTH7-F1 | 888-1264 | 99.46 | 83.27 | View in AlphaFoldDB ↗ |