DPCfam | MC285193
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 311 ± 40 aa |
| Residues in low-complexity regions (%) | 3.09 |
| Residues in coiled-coil regions (%) | 2.78 |
| Predicted disordered residues (%) | 20.13 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF03223 |
| Sequences matching dominant architecture (%) | 90.21 |
| Average overlap percent | 89.6 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0C2J4W0 | 13-301 | 289 | ESLTVHEESIDDFVKCFKWDFAKYPTKQSPKNLVESIIKLVSQVDADLKNRNIHFKNVDSALAQVQKKNSGSLMVRSLNDIVKSD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9U5N1-F1 | 34-345 | 99.36 | 94.76 | View in AlphaFoldDB ↗ |