DPCfam | MC285025
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 323 ± 25 aa |
| Residues in low-complexity regions (%) | 3.47 |
| Residues in coiled-coil regions (%) | 2.09 |
| Predicted disordered residues (%) | 19.91 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF11894 |
| Sequences matching dominant architecture (%) | 72.22 |
| Average overlap percent | 1.09 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R7TWZ3 | 1692-2047 | 356 | LETLQELALTTGVVSRAAIDETPEESMLTDTSSLEFRGLVSRLQRQMIALLPRYCLSAKQFKEIKNSQLLNAEDTQDIEAQMRLA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q92621-F1 | 1671-2008 | 99.38 | 68.86 | View in AlphaFoldDB ↗ |