DPCfam | MC284860
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 272 ± 39 aa |
| Residues in low-complexity regions (%) | 3.06 |
| Residues in coiled-coil regions (%) | 0.16 |
| Predicted disordered residues (%) | 24.04 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00571 |
| Sequences matching dominant architecture (%) | 61.45 |
| Average overlap percent | 16.0 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00056D1B06 | 88-403 | 316 | EFIGIWGHVHRWPSVVEEIEADLEAFGLTTQPSFADYALNLNRRVTVIPVGAEPEPGTHVPTAAELPVAARFDDRPVTVRIGQVA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q58622-F1 | 91-201 | 40.29 | 96.64 | View in AlphaFoldDB ↗ |