DPCfam | MC284267
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 103 ± 19 aa |
| Residues in low-complexity regions (%) | 3.04 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.91 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A058ZYY9 | 1-74 | 74 | MERVLDDESEKKILQALEYAGVFTSGGLIKEKVLFCSTENGRSSFVRQLEPDWHIDTNPEVISQLAVKFLLSLL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B6T4T1-F1 | 165-260 | 96.94 | 95.54 | View in AlphaFoldDB ↗ |