DPCfam | MC283692
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 148 ± 18 aa |
| Residues in low-complexity regions (%) | 2.05 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.71 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01755 |
| Sequences matching dominant architecture (%) | 17.2 |
| Average overlap percent | 25.3 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D2F8V8 | 257-430 | 174 | SPYGDYWDIIWFGHCAAQTDPENDRRYVVTDDPTVLPPWSRSEFVQPDMSVWQEDSDDYLNFQTRIYFRSNWNSCTAAYAISLRG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2D9X7-F1 | 231-373 | 98.56 | 94.61 | View in AlphaFoldDB ↗ |