DPCfam | MC283452
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 108 ± 8 aa |
| Residues in low-complexity regions (%) | 11.43 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.06 |
| Average transmembrane regions | 3.04 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0C2VQP1 | 11-122 | 112 | LLALAALTMVFVRFFFPEVTPFLTTGLLFILFFVFIAVSIVTFDPKASKRDELVGLPVTIYFSVLVVFLQLIGGETDTPLSIDQP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R0HF40-F1 | 15-73 | 52.25 | 64.59 | View in AlphaFoldDB ↗ |