DPCfam | MC283246
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 811 |
|---|---|
| Mean domain length (aa) | 87 ± 18 aa |
| Residues in low-complexity regions (%) | 13.76 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.21 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08659 |
| Sequences matching dominant architecture (%) | 0.17 |
| Average overlap percent | 2.51 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q9LM93 | 2620-2688 | 69 | DTDDRASLAARLRGDGVLSFLALAEHPHAEHPDLPAGLALTLAAVQALHDTGATARFWAATSGAVSTGA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X8EZC8-F1 | 332-417 | 95.88 | 90.51 | View in AlphaFoldDB ↗ |