DPCfam | MC283138
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 241 |
|---|---|
| Mean domain length (aa) | 223 ± 32 aa |
| Residues in low-complexity regions (%) | 2.73 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.18 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | PF01756 |
| Sequences matching dominant architecture (%) | 0.46 |
| Average overlap percent | 6.03 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I8AUG6 | 136-294 | 159 | FSEGYCSGPEFKLIDANASVLNIVRNHLQIHYGRNQNEFIGNDDGTGFKLSGYPFAKFGEFRIGQMGIGQSVRTKHFFKELFSDL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175WI30-F1 | 12-251 | 99.10 | 90.40 | View in AlphaFoldDB ↗ |