DPCfam | MC282800
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 96 ± 6 aa |
| Residues in low-complexity regions (%) | 5.62 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 3.74 |
| Average transmembrane regions | 1.64 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0L0P6K7 | 1-83 | 83 | MILAGLLSWIVGWFRFSLAPVFFIMLVFGILYRSSVRKYREMLRELAQREFSVKSIENDYETMDWLNVFLEKFWRFLEPSVAQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CNF8-F1 | 155-246 | 98.92 | 76.11 | View in AlphaFoldDB ↗ |