DPCfam | MC281908
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 131 ± 20 aa |
| Residues in low-complexity regions (%) | 4.22 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.2 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12454 |
| Sequences matching dominant architecture (%) | 8.29 |
| Average overlap percent | 13.11 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| J7RHX4 | 62-156 | 95 | CANENFILSSSNDLKSIEHCHEIVGDLIVTSTFDSPVLDLYNLQTLKGNFVIEDCQSLIRLSAPQLENVQGDFTLSSLTSLVTVE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4WNS8-F1 | 27-148 | 94.20 | 98.15 | View in AlphaFoldDB ↗ |