DPCfam | MC281755
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 380 ± 98 aa |
| Residues in low-complexity regions (%) | 3.59 |
| Residues in coiled-coil regions (%) | 4.53 |
| Predicted disordered residues (%) | 21.94 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00271 |
| Sequences matching dominant architecture (%) | 1.45 |
| Average overlap percent | 1.68 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P5JPC7 | 1080-1458 | 379 | MKEERQWREKQRISRLQEDFRTMEHEQNFFDELSIYYTELKQELKNQKREDQAIKTICDSVLDIWALWLDQTEDHLKLTYSYHHD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A140LG02-F1 | 356-444 | 28.79 | 87.43 | View in AlphaFoldDB ↗ |