DPCfam | MC281527
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 289 ± 36 aa |
| Residues in low-complexity regions (%) | 4.12 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.99 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00241- PF00241 |
| Sequences matching dominant architecture (%) | 81.3 |
| Average overlap percent | 90.48 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0003316AC0 | 16-285 | 270 | VRLVRVVIVDESLLCDKTVDPQVDGQFQLDPSFVDTNKPCYLFYKLNACSESGADWVRQKMLYASTKAAVKRDFGVASIKYDFLV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9Z0P5-F1 | 25-328 | 99.66 | 92.88 | View in AlphaFoldDB ↗ |