DPCfam | MC281247
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 100 ± 17 aa |
| Residues in low-complexity regions (%) | 9.4 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 40.76 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15336 |
| Sequences matching dominant architecture (%) | 91.89 |
| Average overlap percent | 12.87 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0008742865 | 471-550 | 80 | LFKDIPKLGGVDSSFYRQNMGLPPSYTGYTPGLMHPGLTSGPTPFVPPNHLPTFQPKKTGRWNAMHVRVAWEIYHHQQKS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1X9RK97-F1 | 120-228 | 98.08 | 53.86 | View in AlphaFoldDB ↗ |