DPCfam | MC281212
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 481 |
|---|---|
| Mean domain length (aa) | 128 ± 16 aa |
| Residues in low-complexity regions (%) | 3.98 |
| Residues in coiled-coil regions (%) | 4.17 |
| Predicted disordered residues (%) | 27.98 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11300 |
| Sequences matching dominant architecture (%) | 69.21 |
| Average overlap percent | 67.89 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W8YTW0 | 31-165 | 135 | DIESEIRTYVSEIEAAEVDIARKAIEIGKRLQFVKENDLVHGQWEPWLRSVGIVPQTARKYIQVYEQFGNRPTPSGLTIAKLFEL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077ZQE8-F1 | 8-114 | 84.55 | 87.57 | View in AlphaFoldDB ↗ |