DPCfam | MC281033
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 101 ± 18 aa |
| Residues in low-complexity regions (%) | 3.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 37.49 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01585 |
| Sequences matching dominant architecture (%) | 6.14 |
| Average overlap percent | 10.55 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0L8G4W6 | 242-336 | 95 | VEFAPKDMCRISFRVKDNLHGLGYSGINIMAALPSTHVSLFSEPSKYNNITGIKRNKRGIKGIAFGVGAMEEDDEDIYAADSLSK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VUA0-F1 | 216-320 | 97.03 | 58.94 | View in AlphaFoldDB ↗ |