DPCfam | MC280882
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 670 ± 112 aa |
| Residues in low-complexity regions (%) | 4.38 |
| Residues in coiled-coil regions (%) | 0.01 |
| Predicted disordered residues (%) | 12.09 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF02985 |
| Sequences matching dominant architecture (%) | 5.56 |
| Average overlap percent | 9.4 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0L7R775 | 46-712 | 667 | LKIIILKYKNLLISYIDDLTKILTHTVADNYPLVKRESCDCISEFANNLPNYFYSQAQNLVKPILNNFTHQHYRVRIASIRTIGD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0JMW2-F1 | 94-814 | 99.86 | 95.26 | View in AlphaFoldDB ↗ |