DPCfam | MC280873
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 771 |
|---|---|
| Mean domain length (aa) | 105 ± 10 aa |
| Residues in low-complexity regions (%) | 4.2 |
| Residues in coiled-coil regions (%) | 0.36 |
| Predicted disordered residues (%) | 20.79 |
| Average transmembrane regions | 0.1 |
| Dominant Pfam architecture(s) | PF10728 |
| Sequences matching dominant architecture (%) | 99.85 |
| Average overlap percent | 73.47 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V5PUE9 | 190-306 | 116 | HAAACVASNYLVTLIKYATDIHGSIGIKAEDSMRALSGLIEGTFANIKKIGPTAALTGPIARGDTGTVAEHLYNFSKYLGPGQDV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077ZFA1-F1 | 512-613 | 97.14 | 96.17 | View in AlphaFoldDB ↗ |