DPCfam | MC280584
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 129 ± 11 aa |
| Residues in low-complexity regions (%) | 21.48 |
| Residues in coiled-coil regions (%) | 5.0 |
| Predicted disordered residues (%) | 16.98 |
| Average transmembrane regions | 1.8 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A165LFL1 | 334-461 | 128 | RRRGIEDVLMVALGASAGVGLGRLVVSPLALIPTLAVANTIVSLAIGAAIAWWLTRSRALVADRAHLRGWTQESLARVKSEVDQR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F1K5-F1 | 375-503 | 99.23 | 78.29 | View in AlphaFoldDB ↗ |