DPCfam | MC280383
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 120 ± 46 aa |
| Residues in low-complexity regions (%) | 3.42 |
| Residues in coiled-coil regions (%) | 7.63 |
| Predicted disordered residues (%) | 33.83 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF04716 |
| Sequences matching dominant architecture (%) | 95.51 |
| Average overlap percent | 57.59 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A139AGM0 | 7-112 | 106 | LLKETTGLTGLAVHPNPRPALISLYQKTLSELSDIPETALYRQSISAITSHRLRIVELTEDVSKIEHEIAAGQMEELIQQAQDEL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NXC1-F1 | 19-242 | 99.07 | 83.62 | View in AlphaFoldDB ↗ |