DPCfam | MC280364
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 397 ± 73 aa |
| Residues in low-complexity regions (%) | 6.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 7.9 |
| Average transmembrane regions | 0.65 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F6ZQ68 | 1-334 | 334 | ILQMKAVFTDSLFTGEDEHFLIQRLVGMTQHPLLSTPVKLFYLDCLLHFPENRPLTSNSEENLPVLLTVQMTSSLFPNVFNDHST... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X1WEW1-F1 | 285-669 | 99.47 | 85.10 | View in AlphaFoldDB ↗ |