DPCfam | MC280299
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 166 ± 16 aa |
| Residues in low-complexity regions (%) | 2.77 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.81 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18111 |
| Sequences matching dominant architecture (%) | 94.55 |
| Average overlap percent | 92.33 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009716F43 | 543-707 | 165 | LLVNKLEEDTIIIEIVSISLLEESSIIEDDEVHLLYVEYSFLGHRGEDMETISVQKPQIANQEMFYNFKRKFQIDEQTHPMERET... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q68CZ1-F1 | 1144-1303 | 98.79 | 84.73 | View in AlphaFoldDB ↗ |