DPCfam | MC280241
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 223 ± 25 aa |
| Residues in low-complexity regions (%) | 3.56 |
| Residues in coiled-coil regions (%) | 3.75 |
| Predicted disordered residues (%) | 12.67 |
| Average transmembrane regions | 0.1 |
| Dominant Pfam architecture(s) | PF00787 |
| Sequences matching dominant architecture (%) | 90.77 |
| Average overlap percent | 34.18 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A7YY56 | 6-213 | 208 | PDSQPAQISRRYSDFERLHRNLQRQFRGPMASISFPRKRLRRNFTAETIARRSRAFEQFLGHLQAVPELRHAADLQDFFVLPELR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2T9W1-F1 | 76-297 | 96.10 | 94.35 | View in AlphaFoldDB ↗ |