DPCfam | MC279955
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 136 ± 18 aa |
| Residues in low-complexity regions (%) | 4.34 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.1 |
| Average transmembrane regions | 3.12 |
| Dominant Pfam architecture(s) | PF04061 |
| Sequences matching dominant architecture (%) | 97.35 |
| Average overlap percent | 93.9 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A085M896 | 13-145 | 133 | NSSWLSDRGGWAAYTAGVMVLHLVLRLVLCTPCQFVWTATNVLHNMLMYVIMHMIKGAPWLNTDQGESRRLTYWEQIDSGAQFTD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6EPG3-F1 | 15-154 | 100.00 | 96.49 | View in AlphaFoldDB ↗ |