DPCfam | MC279842
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 308 ± 34 aa |
| Residues in low-complexity regions (%) | 15.66 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 44.69 |
| Average transmembrane regions | 1.0 |
| Dominant Pfam architecture(s) | PF14200 |
| Sequences matching dominant architecture (%) | 17.86 |
| Average overlap percent | 24.65 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A391E7D | 2-296 | 295 | MRAMRDRSGLTYRQLAVRAEEHGDVLPASTLAGALSRGSLPRSEVVEAFVRACGGSPEDVERWLAAHRDLTCGGLHHTGPEDAPV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EN99-F1 | 1-301 | 95.67 | 81.60 | View in AlphaFoldDB ↗ |