DPCfam | MC279655
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 557 ± 68 aa |
| Residues in low-complexity regions (%) | 4.52 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.88 |
| Average transmembrane regions | 0.97 |
| Dominant Pfam architecture(s) | PF06241 |
| Sequences matching dominant architecture (%) | 81.25 |
| Average overlap percent | 16.7 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0004875D15 | 32-622 | 591 | AVIIMGIIIAVSGGSNGPGFGQGLWLSLIHVLDPGTVCGDELTNIPFVFGMLLVTFLGIFIFSTLTGIICNAIDEKIQDLRKGKS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1NCU2-F1 | 244-826 | 99.47 | 88.06 | View in AlphaFoldDB ↗ |