DPCfam | MC27964
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 330 ± 45 aa |
| Residues in low-complexity regions (%) | 10.25 |
| Residues in coiled-coil regions (%) | 0.04 |
| Predicted disordered residues (%) | 36.54 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00643- PF06203 |
| Sequences matching dominant architecture (%) | 44.44 |
| Average overlap percent | 90.58 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q2M5P9 | 7-244 | 238 | NWAQTCDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCQSCERAPAAFFCKADAASLYTACDSQIHSANPLARR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q940T9-F1 | 5-339 | 99.71 | 65.91 | View in AlphaFoldDB ↗ |