DPCfam | MC279588
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 248 ± 47 aa |
| Residues in low-complexity regions (%) | 6.64 |
| Residues in coiled-coil regions (%) | 0.48 |
| Predicted disordered residues (%) | 7.44 |
| Average transmembrane regions | 4.99 |
| Dominant Pfam architecture(s) | PF09772 |
| Sequences matching dominant architecture (%) | 76.23 |
| Average overlap percent | 85.34 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K1QNT9 | 26-254 | 229 | GMEYKWFCPCFFFYLGGTLPSIWLLELDRRERYVSVKEGVYNVTATDSLAEIYPGVSIPISLPADTWVLLIEQFLLYFMIVGRWL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VBE7-F1 | 46-315 | 98.83 | 75.01 | View in AlphaFoldDB ↗ |