DPCfam | MC279525
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 280 ± 43 aa |
| Residues in low-complexity regions (%) | 2.07 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.54 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00640- PF12473 |
| Sequences matching dominant architecture (%) | 50.0 |
| Average overlap percent | 76.13 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B0CC10 | 138-426 | 289 | EIDQDCTIFSGVTYLGAANINAPKSETEIHRNMSELNNISNAVGLKVSVSIPTCSEGLVVLHDASTNAPVAHYEVHRILFYARGP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5RAN1-F1 | 141-402 | 99.26 | 84.02 | View in AlphaFoldDB ↗ |