DPCfam | MC279461
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 361 |
|---|---|
| Mean domain length (aa) | 223 ± 26 aa |
| Residues in low-complexity regions (%) | 2.83 |
| Residues in coiled-coil regions (%) | 0.03 |
| Predicted disordered residues (%) | 13.8 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01433- PF09127 |
| Sequences matching dominant architecture (%) | 87.15 |
| Average overlap percent | 64.88 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S3DE24 | 192-354 | 163 | LSGLKDLKQALKTLGEDNPLTKLIVDLKHTHPDDAFSTCPYEKGHTFLFYLEQLLGGPKDFEPWLKKYLAEFALQSIDTDNFKAH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6S9C8-F1 | 368-598 | 99.57 | 97.79 | View in AlphaFoldDB ↗ |